PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G274700.7
Common NameB456_007G274700, LOC105804607
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 309aa    MW: 33958.9 Da    PI: 6.2857
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G274700.7genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.22.1e-34225279155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr+rWtpeLHe+F+eav+qLGGse+AtPk il+lm+v+gLt++hvkSHLQkYR+
  Gorai.007G274700.7 225 KPRMRWTPELHEAFLEAVNQLGGSERATPKGILKLMNVEGLTIYHVKSHLQKYRT 279
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.615222282IPR017930Myb domain
SuperFamilySSF466897.77E-20223279IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-31224280IPR009057Homeodomain-like
TIGRFAMsTIGR015579.4E-26225279IPR006447Myb domain, plants
PfamPF002496.0E-11227278IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MPSSFLALTS FKDKYSTSPS SFQVSSGREV MENSASLQES SLAPSNGTLG NSSLSPSIVT  60
DHMCASALPH VQYSHNPAFI SQSSRDLASL PPLGASFSQS TASLIHTQGN KDVSWSLDRL  120
QMFLDLPENT PAPNQLVESS TGVLASEDHN KKTNWQEWAD DLINVVDPDW SKILDNTNVL  180
NPRVEVPKPS GDISKQQPQF HQNQLVPHGE FSSHAYPSST APPTKPRMRW TPELHEAFLE  240
AVNQLGGSER ATPKGILKLM NVEGLTIYHV KSHLQKYRTA RYMPETSEGT SEKRITSIEE  300
MKSIDLKT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.14590.0flower| flowering
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012492739.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_012492740.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
TrEMBLA0A0D2PFI00.0A0A0D2PFI0_G
TrEMBLA0A0D2TME40.0A0A0D2TME4_G
STRINGPOPTR_0019s03750.13e-99(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.23e-69G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]